- ►diabetesjournals.org M Tsutsumi, TH Claus, Y Liang, Y Li, L Yang, … - Diabetes, 2002 - Am Diabetes Assoc Pituitary adenylate cyclase—activating peptide (PACAP) and vasoactive
intestinal peptide (VIP) activate two shared receptors, VPAC1 and VPAC2.
Activation of VPAC1 has been implicated in elevating glucose output, ... Cited by 48 - Related articles - BL Direct - All 5 versions
- ►jbc.org SL Yung, D Cruz… - Journal of Biological Chemistry, 2003 - ASBMB Pituitary adenylate cyclase-activating peptide (PACAP) has a specific receptor
PAC1 and shares two receptors VPAC1 and VPAC2 with vasoactive intestinal peptide
(VIP). VPAC2 activation enhances glucose-induced insulin release while ... Cited by 20 - Related articles - BL Direct - All 5 versions
K Filipsson, F Sundler, J Hannibal, B Ahren - Regulatory peptides, 1998 - ncbi.nlm.nih.gov We have studied the localization, receptor occupancy and potency of the
neuropeptide pituitary adenylate cyclase-activating polypeptide (PACAP) in
insulin-producing tissues. Immunocytochemistry showed that PACAP-like ... Cited by 47 - Related articles - All 3 versions
D Moreno, P Gourlet, P De Neef, J Cnudde, … - Peptides, 2000 - ncbi.nlm.nih.gov Ro 25-1553 is a cyclic VIP derivative with a high affinity for the VPAC(2)
receptor subtype. Our goal was to identify the modifications that support its
selectivity for VPAC(2) receptors, and to develop a VIP or Ro 25-1553 ... Cited by 33 - Related articles - All 2 versions
- ►endojournals.org K Filipsson, K Tornoe, J Holst, B Ahren - Journal of Clinical Endocrinology & Metabolism, 1997 - Endocrine Soc Pituitary adenylate cyclase-activating polypeptide (PACAP) has been localized to
pancreatic nerves and demonstrated to stimulate insulin and glucagon secretion
in experimental animals. This study examined the occurrence and possible ... Cited by 53 - Related articles - BL Direct - All 4 versions
K Yamamoto, H Hashimoto, S Tomimoto, N … - Diabetes, 2003 - Am Diabetes Assoc Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the
vasoactive intestinal peptide/secretin/glucagon family, stimulates insulin
secretion from islets in a glucose-dependent manner at femtomolar ... Cited by 36 - Related articles - BL Direct - All 4 versions
K Filipsson, M Kvist-Reimer, B Ahrén - Diabetes, 2001 - Am Diabetes Assoc The neuropeptide pituitary adenylate cyclase–activating polypeptide (PACAP) is
ubiquitously distributed in both the central and peripheral nervous systems and
exerts a variety of effects. PACAP is a neuropeptide in pancreatic islets, ... Cited by 47 - Related articles - BL Direct - All 5 versions
GM Portela-Gomes, A Lukinius, O Ljungberg, … - Regulatory peptides, 2003 - 万方数据资源系统 Pituitary adenylate cyclase-activating polypeptide (PACAP) is an islet
neuropeptide with potent insulinotropic action. The current study investigates
PACAP expression in normal human and rat pancreatic islets, and whether it ... Cited by 14 - Related articles - All 4 versions
T Yada, M Sakurada, K Filipsson, M Kikuchi, … - Annals of the New York Academy of Sciences, 2000 - ncbi.nlm.nih.gov PACAP is an islet peptide that serves as an endogenous amplifier of glucose
induced insulin secretion. Furthermore, we has recently found that PACAP also
potentiates insulin stimulated glucose uptake in adipocytes. Therefore, an ... Cited by 28 - Related articles - BL Direct - All 3 versions
- ►aspetjournals.org CQ Pan, F Li, I Tom, W Wang, M Dumas, W … - Journal of Pharmacology and Experimental …, 2007 - ASPET A previously described VPAC2-selective agonist, BAY 55-9837 (peptide
HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY), had several limitations with respect to its
potential as an insulin secretagogue for the treatment of type 2 diabetes. ... Cited by 9 - Related articles - All 6 versions
